Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Mallets (16oz)
16oz Rubber Bivvy Mallets. Fully handle wrapped with your choice of 550 US 7 Strand Paracord in a bell rope fashion giving excellent grip. Available in a range of 'Carpy' colours.
2 product(s) found for "Mallets (16oz)"
Army Green Camo Paracord 'Ha..
Mallets (16oz)
Army Green Camo Paracord 'Ha..
'Army Green Camo' Paracord 'Bell Rope Wrapped Handle' Carp Fishing Bivvy Mallet. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. 16oz Handle Wrapped Rubber Mallet....
£16.95
Units in Stock: 1
£16.95
Details
Add To Cart
'Army Green Camo' Paracord 'Bell Rope Wrapped Handle' Carp Fishing Bivvy Mallet. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. 16oz Handle Wrapped Rubber Mallet....
'Olive Green Camo' Paracord ..
Mallets (16oz)
'Olive Green Camo' Paracord ..
'Olive Green Camo' Paracord 'Bell Rope Wrapped Handle' Carp Fishing Bivvy Mallet. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. 16oz Handle Wrapped Rubber...
£15.95
Units in Stock: 0
£15.95
Details
Add To Cart
'Olive Green Camo' Paracord 'Bell Rope Wrapped Handle' Carp Fishing Bivvy Mallet. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. 16oz Handle Wrapped Rubber...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i