Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Rod Pod Stabiliser Straps
Our Rod Pod Retainer/Stabiliser Straps are available in over 10 Carpy colours! Handmade using 550 US Paracord which is UV, mildew & rot resistant. 2 Spliced 20mm metal rings for peg attachment. Approx length 50cm.
12 product(s) found for "Rod Pod Stabiliser Straps"
Black Rod Pod Retainer/Stabi..
Rod Pod Stabiliser Straps
Black Rod Pod Retainer/Stabi..
'Black' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either...
£5.95
Units in Stock: 4
£5.95
Details
Add To Cart
'Black' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either...
Cobra Rod Pod Retainer/Stabi..
Rod Pod Stabiliser Straps
Cobra Rod Pod Retainer/Stabi..
'Cobra' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either...
£5.95
Units in Stock: 4
£5.95
Details
Add To Cart
'Cobra' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either...
Code Talker Rod Pod Retainer..
Rod Pod Stabiliser Straps
Code Talker Rod Pod Retainer..
Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either end. Simply loop around your pod and place...
£5.95
Units in Stock: 4
£5.95
Details
Add To Cart
Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either end. Simply loop around your pod and place...
Ground War Rod Pod Retainer/..
Rod Pod Stabiliser Straps
Ground War Rod Pod Retainer/..
'Ground War' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either...
£5.95
Units in Stock: 2
£5.95
Details
Add To Cart
'Ground War' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either...
Hunter Green Rod Pod Retaine..
Rod Pod Stabiliser Straps
Hunter Green Rod Pod Retaine..
'Hunter Green' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings...
£5.95
Units in Stock: 4
£5.95
Details
Add To Cart
'Hunter Green' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings...
Neon Green Rod Pod Retainer/..
Rod Pod Stabiliser Straps
Neon Green Rod Pod Retainer/..
Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either end. Simply loop around your pod and place...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either end. Simply loop around your pod and place...
Neon Orange Rod Pod Retainer..
Rod Pod Stabiliser Straps
Neon Orange Rod Pod Retainer..
Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either end. Simply loop around your pod and place...
£5.95
Units in Stock: 4
£5.95
Details
Add To Cart
Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either end. Simply loop around your pod and place...
Olive Green Rod Pod Retainer..
Rod Pod Stabiliser Straps
Olive Green Rod Pod Retainer..
'Olive Green' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings...
£5.95
Units in Stock: 2
£5.95
Details
Add To Cart
'Olive Green' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings...
Recon Camo Rod Pod Retainer/..
Rod Pod Stabiliser Straps
Recon Camo Rod Pod Retainer/..
'Recon Camo' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either...
£5.95
Units in Stock: 4
£5.95
Details
Add To Cart
'Recon Camo' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either...
Siberian Camo Rod Pod Retain..
Rod Pod Stabiliser Straps
Siberian Camo Rod Pod Retain..
'Siberian Camo' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings...
£5.95
Units in Stock: 4
£5.95
Details
Add To Cart
'Siberian Camo' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings...
Urban Camo Rod Pod Retainer/..
Rod Pod Stabiliser Straps
Urban Camo Rod Pod Retainer/..
'Urban Camo' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either...
£5.95
Units in Stock: 4
£5.95
Details
Add To Cart
'Urban Camo' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings either...
Woodland Camo Rod Pod Retain..
Rod Pod Stabiliser Straps
Woodland Camo Rod Pod Retain..
'Woodland Camo' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings...
£5.95
Units in Stock: 4
£5.95
Details
Add To Cart
'Woodland Camo' Rod Pod Retainer/Stabiliser Strap Secure your rod pod from moving during strong runs with this paracord retainer strap. Made from 550 US Paracord with 3mm thick 20mm diameter metal rings...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i