Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Bivvy Zip Pulls-Skulls
A selection of practical 'Skull' Bivvy Zip Pulls ideal for a multitude of uses including bivvy doors, clothing and luggage items. Handmade using 425 3 strand US paracord with olive green skulls.
10 product(s) found for "Bivvy Zip Pulls-Skulls"
Canadian Digital 1 Pair Hand..
Bivvy Zip Pulls-Skulls
Canadian Digital 1 Pair Hand..
'Canadian Digital' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including skull cap. An ideal addition...
£3.95
Units in Stock: 3
£3.95
Details
Add To Cart
'Canadian Digital' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including skull cap. An ideal addition...
Forest Camo 1 Pair Handmade ..
Bivvy Zip Pulls-Skulls
Forest Camo 1 Pair Handmade ..
'Forest Camo' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including plastic cap. An ideal addition for...
£3.95
Units in Stock: 3
£3.95
Details
Add To Cart
'Forest Camo' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including plastic cap. An ideal addition for...
Gravel Camo 1 Pair Handmade ..
Bivvy Zip Pulls-Skulls
Gravel Camo 1 Pair Handmade ..
'Gravel Camo' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including skull cap. An ideal addition for a...
£3.95
Units in Stock: 3
£3.95
Details
Add To Cart
'Gravel Camo' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including skull cap. An ideal addition for a...
Moss & Black Stripes 1 Pair ..
Bivvy Zip Pulls-Skulls
Moss & Black Stripes 1 Pair ..
'Moss & Black Stripes' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including plastic cap. An ideal addition...
£3.95
Units in Stock: 3
£3.95
Details
Add To Cart
'Moss & Black Stripes' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including plastic cap. An ideal addition...
Multi Camo 1 Pair Handmade S..
Bivvy Zip Pulls-Skulls
Multi Camo 1 Pair Handmade S..
'Multi Camo' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including plastic cap. An ideal addition for...
£3.95
Units in Stock: 3
£3.95
Details
Add To Cart
'Multi Camo' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including plastic cap. An ideal addition for...
Olive Drab & Moss 1 Pair Han..
Bivvy Zip Pulls-Skulls
Olive Drab & Moss 1 Pair Han..
'Olive Drab & Moss' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including skull cap. An ideal addition...
£3.95
Units in Stock: 3
£3.95
Details
Add To Cart
'Olive Drab & Moss' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including skull cap. An ideal addition...
Olive Green 1 Pair Handmade ..
Bivvy Zip Pulls-Skulls
Olive Green 1 Pair Handmade ..
'Olive Green' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including skull cap. An ideal addition for a...
£3.95
Units in Stock: 3
£3.95
Details
Add To Cart
'Olive Green' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including skull cap. An ideal addition for a...
Tactical Camo 1 Pair Handmad..
Bivvy Zip Pulls-Skulls
Tactical Camo 1 Pair Handmad..
'Tactical Camo' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including plastic cap. An ideal addition for...
£3.95
Units in Stock: 3
£3.95
Details
Add To Cart
'Tactical Camo' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including plastic cap. An ideal addition for...
'Urban Camo' Skull Bivvy Zip..
Bivvy Zip Pulls-Skulls
'Urban Camo' Skull Bivvy Zip..
'Urban Camo' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including skull cap. An ideal addition for a...
£3.95
Units in Stock: 1
£3.95
Details
Add To Cart
'Urban Camo' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including skull cap. An ideal addition for a...
Woodland Camo 1 Pair Handmad..
Bivvy Zip Pulls-Skulls
Woodland Camo 1 Pair Handmad..
'Woodland Camo' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including skull cap. An ideal addition for...
£3.95
Units in Stock: 3
£3.95
Details
Add To Cart
'Woodland Camo' Skull Bivvy Zip Pull (1 Pair) Handmade to order here in the UK using 425 US 3 Strand Paracord. Mildew and rot resistant. Approximate length 3" including skull cap. An ideal addition for...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i