Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Snake Knot Lanyards
Our Snake Knot Neck Lanyards are a handy item suitable for a range of uses including Bite Alarm Receivers, ID Cards, Keys, Multi Tools, Torches, Maps etc. Available in a range of #Proper Carpy colour designs. All include a safety breakaway barrel on the neck strap and are approximately 50cm in length.
20 product(s) found for "Snake Knot Lanyards"
Army Green Camo Paracord 'Sn..
Snake Knot Lanyards
Army Green Camo Paracord 'Sn..
'Army Green Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Army Green Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
Black Paracord 'Snake Knot' ..
Snake Knot Lanyards
Black Paracord 'Snake Knot' ..
'Black' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Black' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
Blitz Camo Paracord 'Snake K..
Snake Knot Lanyards
Blitz Camo Paracord 'Snake K..
'Blitz Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Blitz Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
Boy Scout Paracord 'Snake Kn..
Snake Knot Lanyards
Boy Scout Paracord 'Snake Kn..
'Boy Scout' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Boy Scout' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
Brown Paracord 'Snake Knot' ..
Snake Knot Lanyards
Brown Paracord 'Snake Knot' ..
'Brown' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Brown' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
Coyote Brown Paracord 'Snake..
Snake Knot Lanyards
Coyote Brown Paracord 'Snake..
'Coyote Brown' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Coyote Brown' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
Desert Storm Paracord 'Snake..
Snake Knot Lanyards
Desert Storm Paracord 'Snake..
'Desert Storm' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Desert Storm' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
Front Range Camo Paracord 'S..
Snake Knot Lanyards
Front Range Camo Paracord 'S..
'Front Range Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Front Range Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
Graphite Paracord 'Snake Kno..
Snake Knot Lanyards
Graphite Paracord 'Snake Kno..
'Graphite' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Graphite' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
Hidden Camo Paracord 'Snake ..
Snake Knot Lanyards
Hidden Camo Paracord 'Snake ..
'Hidden Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Hidden Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
Infiltrate Paracord 'Snake K..
Snake Knot Lanyards
Infiltrate Paracord 'Snake K..
'Infiltrate' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Infiltrate' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
Jager Camo Paracord 'Snake K..
Snake Knot Lanyards
Jager Camo Paracord 'Snake K..
'Jager Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Jager Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
Multi Camo Paracord 'Snake K..
Snake Knot Lanyards
Multi Camo Paracord 'Snake K..
'Multi Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Multi Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
Olive Drab & Moss Paracord '..
Snake Knot Lanyards
Olive Drab & Moss Paracord '..
'Olive Drab & Moss' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card,...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Olive Drab & Moss' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card,...
Rattler Camo Paracord 'Snake..
Snake Knot Lanyards
Rattler Camo Paracord 'Snake..
'Rattler Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Rattler Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
Recon Camo Paracord 'Snake K..
Snake Knot Lanyards
Recon Camo Paracord 'Snake K..
'Recon Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Recon Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
Tomahawk Paracord 'Snake Kno..
Snake Knot Lanyards
Tomahawk Paracord 'Snake Kno..
'Tomahawk' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Tomahawk' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
Touch Of Grey Paracord 'Snak..
Snake Knot Lanyards
Touch Of Grey Paracord 'Snak..
'Touch Of Grey' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Touch Of Grey' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys,...
Treestand Paracord 'Snake Kn..
Snake Knot Lanyards
Treestand Paracord 'Snake Kn..
'Treestand' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Treestand' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
Urban Camo Paracord 'Snake K..
Snake Knot Lanyards
Urban Camo Paracord 'Snake K..
'Urban Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
£5.95
Units in Stock: 3
£5.95
Details
Add To Cart
'Urban Camo' Paracord 'Snake Knot Neck Lanyard'. Handmade using the highest quality USA 550 seven strand Paracord. Mildew and rot resistant. Suitable for a wide range of uses including ID Card, Keys, Multi...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i